Sample Input	Explanations/Comments
yqzhou@iupui.edu >1cew GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVR VISAKRQLVSGIKYILQVEIGRTTCPKSSGDL QSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ Number of models by MODELLER 6 v1 (<=10) (optional,default is # of significant matches found) Target ID (optional)	Your email address. If your email address is entered, the result will be emailed. It will also show in the browser window (if not closed). The format for your sequence named 1cew Enter a number only if you want to build structures even for the matches that are not significant. You assigned identification if any